Class a: All alpha proteins [46456] (290 folds) |
Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) multihelical |
Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) duplication: contains two structural repeats |
Family a.86.1.0: automated matches [254307] (1 protein) not a true family |
Protein automated matches [254708] (4 species) not a true protein |
Species Streptomyces castaneoglobisporus [TaxId:79261] [361811] (12 PDB entries) |
Domain d5z0da1: 5z0d A:2-273 [361849] Other proteins in same PDB: d5z0da2, d5z0db_ automated match to d4hd7a_ complexed with cu, no3 |
PDB Entry: 5z0d (more details), 1.16 Å
SCOPe Domain Sequences for d5z0da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z0da1 a.86.1.0 (A:2-273) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]} tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt pdvvdlnetmkpwntvrpadlldhtayytfda
Timeline for d5z0da1: