Lineage for d5z0db_ (5z0d B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2567863Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
    2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386
  4. 2567864Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (1 family) (S)
    Pfam PF06236
  5. 2567865Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (1 protein)
  6. 2567866Protein Tyrosinase cofactor MelC1 [254410] (1 species)
  7. 2567867Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries)
  8. 3061820Domain d5z0db_: 5z0d B: [361882]
    Other proteins in same PDB: d5z0da1, d5z0da2
    automated match to d2zmzb_
    complexed with cu, no3

Details for d5z0db_

PDB Entry: 5z0d (more details), 1.16 Å

PDB Description: 1.16 a-resolution crystal structure of the deoxy-form tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein
PDB Compounds: (B:) MelC

SCOPe Domain Sequences for d5z0db_:

Sequence, based on SEQRES records: (download)

>d5z0db_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagggahhhehgggyevfvdgvqlhvmrnadgswisvvshyd
pvptpraaaraavdelqgapllpfpa

Sequence, based on observed residues (ATOM records): (download)

>d5z0db_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpahehgggyevfvdgvqlhvmrnadgswisvvshydpvptpr
aaaraavdelqgapllpfpa

SCOPe Domain Coordinates for d5z0db_:

Click to download the PDB-style file with coordinates for d5z0db_.
(The format of our PDB-style files is described here.)

Timeline for d5z0db_:

  • d5z0db_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27