Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein automated matches [190370] (2 species) not a true protein |
Species Schistosoma mansoni [TaxId:6183] [361055] (2 PDB entries) |
Domain d6ezua_: 6ezu A: [361078] automated match to d3g58a_ complexed with amp, cmp, mg, zn |
PDB Entry: 6ezu (more details), 2.04 Å
SCOPe Domain Sequences for d6ezua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ezua_ a.211.1.2 (A:) automated matches {Schistosoma mansoni [TaxId: 6183]} lpihgvetpndneleerfslcldewgvdifeidrlsnghalttvayrifqkrdllktfci dphvfvryllrvestyhadvpyhnsmhaadvlqtahfllqaealddvfsdleilavlfaa aihdvdhpgvtnqflintghelalqyndasvlenhhlymafkiltekdcdifanlggkkr qtlrrmvielvlatdmskhmslladlrtmvetkkvsgsgmlnldnyadriqilqnmihca dlsnpakplrlyrkwtgrlieeffrqgdkerelsleispmcdresveveksqvsfidfvc hplwetwcdlvhpcaqlildtlednrdwyechi
Timeline for d6ezua_: