SCOPe 2.07: Domain d6ezua_: 6ezu A:

Lineage for d6ezua_ (6ezu A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (2 species)
   not a true protein

7. Species Schistosoma mansoni [TaxId:6183] [361055] (2 PDB entries)

8. Domain d6ezua_: 6ezu A: [361078]
   automated match to d3g58a_
   complexed with amp, cmp, mg, zn

Details for d6ezua_

PDB Entry: 6ezu, 2.04 Å

PDB Description: schistosoma mansoni phosphodiesterase 4a

PDB Compounds: (A:) phosphodiesterase

SCOPe Domain Sequences for d6ezua_:

Sequence; same for both SEQRES and ATOM records:

>d6ezua_ a.211.1.2 (A:) automated matches {Schistosoma mansoni [TaxId: 6183]}
lpihgvetpndneleerfslcldewgvdifeidrlsnghalttvayrifqkrdllktfci
dphvfvryllrvestyhadvpyhnsmhaadvlqtahfllqaealddvfsdleilavlfaa
aihdvdhpgvtnqflintghelalqyndasvlenhhlymafkiltekdcdifanlggkkr
qtlrrmvielvlatdmskhmslladlrtmvetkkvsgsgmlnldnyadriqilqnmihca
dlsnpakplrlyrkwtgrlieeffrqgdkerelsleispmcdresveveksqvsfidfvc
hplwetwcdlvhpcaqlildtlednrdwyechi

Timeline for d6ezua_:

• d6ezua_ is new in SCOPe 2.07-stable
  
• d6ezua_ appears in the current release, SCOPe 2.08