Lineage for d6ezua_ (6ezu A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342214Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2342501Protein automated matches [190370] (2 species)
    not a true protein
  7. 3060993Species Schistosoma mansoni [TaxId:6183] [361055] (1 PDB entry)
  8. 3061016Domain d6ezua_: 6ezu A: [361078]
    automated match to d3g58a_
    complexed with amp, cmp, mg, zn

Details for d6ezua_

PDB Entry: 6ezu (more details), 2.04 Å

PDB Description: schistosoma mansoni phosphodiesterase 4a
PDB Compounds: (A:) phosphodiesterase

SCOPe Domain Sequences for d6ezua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezua_ a.211.1.2 (A:) automated matches {Schistosoma mansoni [TaxId: 6183]}
lpihgvetpndneleerfslcldewgvdifeidrlsnghalttvayrifqkrdllktfci
dphvfvryllrvestyhadvpyhnsmhaadvlqtahfllqaealddvfsdleilavlfaa
aihdvdhpgvtnqflintghelalqyndasvlenhhlymafkiltekdcdifanlggkkr
qtlrrmvielvlatdmskhmslladlrtmvetkkvsgsgmlnldnyadriqilqnmihca
dlsnpakplrlyrkwtgrlieeffrqgdkerelsleispmcdresveveksqvsfidfvc
hplwetwcdlvhpcaqlildtlednrdwyechi

SCOPe Domain Coordinates for d6ezua_:

Click to download the PDB-style file with coordinates for d6ezua_.
(The format of our PDB-style files is described here.)

Timeline for d6ezua_:

  • d6ezua_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13