Lineage for d5zdla1 (5zdl A:3-337)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861157Species Thermus thermophilus [TaxId:300852] [360920] (3 PDB entries)
  8. 2861159Domain d5zdla1: 5zdl A:3-337 [360962]
    Other proteins in same PDB: d5zdla2
    automated match to d4jxxa1
    complexed with atp, cl

Details for d5zdla1

PDB Entry: 5zdl (more details), 2.6 Å

PDB Description: crystal structure analysis of ttqrs in co-crystallised with atp
PDB Compounds: (A:) Glutamine--tRNA ligase

SCOPe Domain Sequences for d5zdla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zdla1 c.26.1.0 (A:3-337) automated matches {Thermus thermophilus [TaxId: 300852]}
lvpecfitelverdlkegkyaklvtrfppepngylhigharsivlnfglaqdyggecnlr
fddtnpetekeeyaraieedvrwlgfrptrvlyasdyfetmyqcalvliqegkayvddlp
eeemselraqgkpspyrersveenlelfermrrgefptgsrvlrakidpahpnfklrdpv
lyrivhaphyhvgdrwviypmydfahpledfiegvthslctlefennrtvydwvienlkg
kcglptsprphqyefarldlshtvlskrkliklveggyvsgwddprlptlrglrrrgvrp
eaivefvrktgisrneaqiemdlfeevvrddlnpi

SCOPe Domain Coordinates for d5zdla1:

Click to download the PDB-style file with coordinates for d5zdla1.
(The format of our PDB-style files is described here.)

Timeline for d5zdla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zdla2