Lineage for d5zdla2 (5zdl A:338-543)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394256Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2394257Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2394341Family b.53.1.0: automated matches [270315] (1 protein)
    not a true family
  6. 2394342Protein automated matches [270316] (3 species)
    not a true protein
  7. 3060860Species Thermus thermophilus [TaxId:300852] [360922] (3 PDB entries)
  8. 3060901Domain d5zdla2: 5zdl A:338-543 [360963]
    Other proteins in same PDB: d5zdla1
    automated match to d4jxxa2
    complexed with atp, cl

Details for d5zdla2

PDB Entry: 5zdl (more details), 2.6 Å

PDB Description: crystal structure analysis of ttqrs in co-crystallised with atp
PDB Compounds: (A:) Glutamine--tRNA ligase

SCOPe Domain Sequences for d5zdla2:

Sequence, based on SEQRES records: (download)

>d5zdla2 b.53.1.0 (A:338-543) automated matches {Thermus thermophilus [TaxId: 300852]}
aprvlgvvdplkvvltnyegeewieapywprdipkegtrplpfspelyiertdfslnppk
gwkrlapgqrvrlrhayvieledvveeggevrllkarivpgtlganpedgvrpkgvihwv
sarhalpvefrlygrlfrtkdpeeggdflqnlnpealvvkrgfiepsvaqdpedtryqle
rlgyfwrdpvdsrpealvmnrivplk

Sequence, based on observed residues (ATOM records): (download)

>d5zdla2 b.53.1.0 (A:338-543) automated matches {Thermus thermophilus [TaxId: 300852]}
aprvlgvvdplkvvltnyegeewieapywprdipkegtrplpfspelyiertdfslnppk
gwkrlapgqrvrlrhayvieledvveeggevrllkarivtlganpedgvrpkgvihwvsa
rhalpvefrlygrlfrtkdpeeggdflqnlnpealvvkrgfiepsvaqdpedtryqlerl
gyfwrdpvdsrpealvmnrivplk

SCOPe Domain Coordinates for d5zdla2:

Click to download the PDB-style file with coordinates for d5zdla2.
(The format of our PDB-style files is described here.)

Timeline for d5zdla2:

  • d5zdla2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5zdla1