SCOPe 2.07: Domain d6a97a2: 6a97 A:184-275

Lineage for d6a97a2 (6a97 A:184-275)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6a97a2: 6a97 A:184-275 [360817]
   Other proteins in same PDB: d6a97a1, d6a97b_, d6a97d_
   automated match to d4l4va2
   complexed with so4

Details for d6a97a2

PDB Entry: 6a97, 2.15 Å

PDB Description: crystal structure of mhc-like mill2

PDB Compounds: (A:) MHC I-like leukocyte 2 long form

SCOPe Domain Sequences for d6a97a2:

Sequence; same for both SEQRES and ATOM records:

>d6a97a2 b.1.1.0 (A:184-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tgppmvtvtcrnypvgrvtltcrafnlytreatlvwlqdgkpvqqktfrsetilpsgdgt
yqarvsirvlpgqepqfscnlrhgnhsimqta

Timeline for d6a97a2:

• d6a97a2 is new in SCOPe 2.07-stable
  
• d6a97a2 appears in the current release, SCOPe 2.08