Lineage for d6a97a2 (6a97 A:184-275)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (667 PDB entries)
  8. 3060755Domain d6a97a2: 6a97 A:184-275 [360817]
    Other proteins in same PDB: d6a97a1, d6a97b_, d6a97d_
    automated match to d4l4va2
    complexed with so4

Details for d6a97a2

PDB Entry: 6a97 (more details), 2.15 Å

PDB Description: crystal structure of mhc-like mill2
PDB Compounds: (A:) MHC I-like leukocyte 2 long form

SCOPe Domain Sequences for d6a97a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a97a2 b.1.1.0 (A:184-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tgppmvtvtcrnypvgrvtltcrafnlytreatlvwlqdgkpvqqktfrsetilpsgdgt
yqarvsirvlpgqepqfscnlrhgnhsimqta

SCOPe Domain Coordinates for d6a97a2:

Click to download the PDB-style file with coordinates for d6a97a2.
(The format of our PDB-style files is described here.)

Timeline for d6a97a2:

  • d6a97a2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06