SCOPe 2.07: Domain d6a97a1: 6a97 A:6-180

Lineage for d6a97a1 (6a97 A:6-180)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6a97a1: 6a97 A:6-180 [360816]
   Other proteins in same PDB: d6a97a2, d6a97b_, d6a97c1, d6a97d_
   automated match to d4l4va1
   complexed with so4

Details for d6a97a1

PDB Entry: 6a97, 2.15 Å

PDB Description: crystal structure of mhc-like mill2

PDB Compounds: (A:) MHC I-like leukocyte 2 long form

SCOPe Domain Sequences for d6a97a1:

Sequence; same for both SEQRES and ATOM records:

>d6a97a1 d.19.1.0 (A:6-180) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
thtlrynvrahslegsektqllvliyvdeelflkyngdsreteplgcwikghggnetcar
etnnllkveeklrgmmaevinqksqeeglhtlqatlgcellsngstrgfwhlgydgqnfl
tfdqktltwtvdgpstqqnkmfwkthapradlvktflddicpahlqrylaslrng

Timeline for d6a97a1:

• d6a97a1 is new in SCOPe 2.07-stable
  
• d6a97a1 appears in the current release, SCOPe 2.08