Lineage for d6a97a1 (6a97 A:6-180)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507687Species Mouse (Mus musculus) [TaxId:10090] [224924] (54 PDB entries)
  8. 3060754Domain d6a97a1: 6a97 A:6-180 [360816]
    Other proteins in same PDB: d6a97a2, d6a97b_, d6a97c1, d6a97d_
    automated match to d4l4va1
    complexed with so4

Details for d6a97a1

PDB Entry: 6a97 (more details), 2.15 Å

PDB Description: crystal structure of mhc-like mill2
PDB Compounds: (A:) MHC I-like leukocyte 2 long form

SCOPe Domain Sequences for d6a97a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a97a1 d.19.1.0 (A:6-180) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
thtlrynvrahslegsektqllvliyvdeelflkyngdsreteplgcwikghggnetcar
etnnllkveeklrgmmaevinqksqeeglhtlqatlgcellsngstrgfwhlgydgqnfl
tfdqktltwtvdgpstqqnkmfwkthapradlvktflddicpahlqrylaslrng

SCOPe Domain Coordinates for d6a97a1:

Click to download the PDB-style file with coordinates for d6a97a1.
(The format of our PDB-style files is described here.)

Timeline for d6a97a1:

  • d6a97a1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06