Lineage for d5ystb_ (5yst B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2394985Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (36 PDB entries)
  8. 3060507Domain d5ystb_: 5yst B: [360569]
    Other proteins in same PDB: d5ysta_
    automated match to d5uwsb_
    complexed with cl, edo, gol, gtp, mg

Details for d5ystb_

PDB Entry: 5yst (more details), 2.04 Å

PDB Description: ranm189d in complex with ranbp1-crm1
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d5ystb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ystb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkican
hiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqei
nkk

SCOPe Domain Coordinates for d5ystb_:

Click to download the PDB-style file with coordinates for d5ystb_.
(The format of our PDB-style files is described here.)

Timeline for d5ystb_:

  • d5ystb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22