Lineage for d5zn0a_ (5zn0 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544570Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2544571Species Human (Homo sapiens) [TaxId:9606] [75559] (140 PDB entries)
  8. 3060501Domain d5zn0a_: 5zn0 A: [360563]
    automated match to d3at3a_
    complexed with dod, so4

Details for d5zn0a_

PDB Entry: 5zn0 (more details), 1.1 Å

PDB Description: joint x-ray/neutron structure of protein kinase ck2 alpha subunit
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5zn0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zn0a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldyahsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgamlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytvvk

SCOPe Domain Coordinates for d5zn0a_:

Click to download the PDB-style file with coordinates for d5zn0a_.
(The format of our PDB-style files is described here.)

Timeline for d5zn0a_:

  • d5zn0a_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22