Lineage for d1qlvb2 (1qlv B:236-393)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186537Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 186538Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 186670Family c.95.1.2: Chalcone synthase [53914] (2 proteins)
  6. 186711Protein Pyrone synthase (PyS, chalcone synthase 2) [53917] (1 species)
  7. 186712Species Gerbera hybrida [53918] (2 PDB entries)
  8. 186720Domain d1qlvb2: 1qlv B:236-393 [36014]

Details for d1qlvb2

PDB Entry: 1qlv (more details), 2.1 Å

PDB Description: pyrone synthase (pys) from gerbera hybrida

SCOP Domain Sequences for d1qlvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlvb2 c.95.1.2 (B:236-393) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrida}
averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl
gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr
krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvr

SCOP Domain Coordinates for d1qlvb2:

Click to download the PDB-style file with coordinates for d1qlvb2.
(The format of our PDB-style files is described here.)

Timeline for d1qlvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qlvb1