PDB entry 1qlv

View 1qlv on RCSB PDB site
Description: pyrone synthase (pys) from gerbera hybrida
Deposited on 1999-09-16, released 2000-09-24
The last revision prior to the SCOP 1.61 freeze date was dated 2000-09-24, with a file datestamp of 2000-09-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlvA (A:)
    aqglatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylal
    tedylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifctt
    agvdmpgadyqlvkllglspsvkrymlyqqgaaaggtvlrlakdlaennkgsrvlivcse
    itailfhgpnenhldslvaqalfgdgaaalivgsgphlaverpifeivstdqtilpdtek
    amklhlreggltfqlhrdvplmvaknienaaekalsplgitdwnsvfwmvhpggraildq
    verklnlkedklrasrhvlseygnlisacvlfiidevrkrsmaegksttgegldcgvlfg
    fgpgmtvetvvlrsvrvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlvB (B:)
    aqglatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylal
    tedylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifctt
    agvdmpgadyqlvkllglspsvkrymlyqqgaaaggtvlrlakdlaennkgsrvlivcse
    itailfhgpnenhldslvaqalfgdgaaalivgsgphlaverpifeivstdqtilpdtek
    amklhlreggltfqlhrdvplmvaknienaaekalsplgitdwnsvfwmvhpggraildq
    verklnlkedklrasrhvlseygnlisacvlfiidevrkrsmaegksttgegldcgvlfg
    fgpgmtvetvvlrsvr