| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein Pyrone synthase (PyS, chalcone synthase 2), C-terminal domain [419039] (1 species) |
| Species Gerbera hybrid cultivar [TaxId:18101] [419523] (2 PDB entries) |
| Domain d1qlvb2: 1qlv B:236-393 [36014] Other proteins in same PDB: d1qlva1, d1qlvb1 |
PDB Entry: 1qlv (more details), 2.1 Å
SCOPe Domain Sequences for d1qlvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlvb2 c.95.1.2 (B:236-393) Pyrone synthase (PyS, chalcone synthase 2), C-terminal domain {Gerbera hybrid cultivar [TaxId: 18101]}
averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl
gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr
krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvr
Timeline for d1qlvb2: