SCOPe 2.08: Domain d6beja1: 6bej A:2-90

Lineage for d6beja1 (6bej A:2-90)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Xanthomonas citri [TaxId:346] [359573] (1 PDB entry)

8. Domain d6beja1: 6bej A:2-90 [359574]
   Other proteins in same PDB: d6beja2, d6beje2
   automated match to d2awpa1
   complexed with mn

Details for d6beja1

PDB Entry: 6bej, 1.89 Å

PDB Description: crystal structure of manganese superoxide dismutase from xanthomonas citri

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6beja1:

Sequence; same for both SEQRES and ATOM records:

>d6beja1 a.2.11.0 (A:2-90) automated matches {Xanthomonas citri [TaxId: 346]}
aytlpqlpyaydalepnidaqtmeihhtkhhqtyinnvnaalegteyadlpieelvsklk
slpenlqgpvrnnggghanhslfwtvlsp

Timeline for d6beja1:

• d6beja1 first appeared in SCOPe 2.07