Lineage for d6beje2 (6bej E:91-202)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2514007Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2514008Protein automated matches [226860] (35 species)
    not a true protein
  7. 3059513Species Xanthomonas citri [TaxId:346] [359575] (1 PDB entry)
  8. 3059652Domain d6beje2: 6bej E:91-202 [359714]
    Other proteins in same PDB: d6beja1, d6beje1
    automated match to d2awpa2
    complexed with mn

Details for d6beje2

PDB Entry: 6bej (more details), 1.89 Å

PDB Description: crystal structure of manganese superoxide dismutase from xanthomonas citri
PDB Compounds: (E:) superoxide dismutase

SCOPe Domain Sequences for d6beje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6beje2 d.44.1.0 (E:91-202) automated matches {Xanthomonas citri [TaxId: 346]}
ngggepkgevakaidkdlggfekfkeaftkaavsrfgsgwawlsvtpdkklvvestanqd
splfegntpilgldvwehayylkyqnrrpeyigafynavnweeverryhaai

SCOPe Domain Coordinates for d6beje2:

Click to download the PDB-style file with coordinates for d6beje2.
(The format of our PDB-style files is described here.)

Timeline for d6beje2:

  • d6beje2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from same chain:
(mouse over for more information)
d6beje1