SCOPe 2.08: Domain d1dlub2: 1dlu B:269-392

Lineage for d1dlub2 (1dlu B:269-392)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Biosynthetic thiolase, C-terminal domain [419021] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [419503] (16 PDB entries)
   Uniprot P07097

8. Domain d1dlub2: 1dlu B:269-392 [35919]
   Other proteins in same PDB: d1dlua1, d1dlub1, d1dluc1, d1dlud1
   complexed with mpd, so4

Details for d1dlub2

PDB Entry: 1dlu, 2.25 Å

PDB Description: unliganded biosynthetic thiolase from zoogloea ramigera

PDB Compounds: (B:) biosynthetic thiolase

SCOPe Domain Sequences for d1dlub2:

Sequence; same for both SEQRES and ATOM records:

>d1dlub2 c.95.1.1 (B:269-392) Biosynthetic thiolase, C-terminal domain {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

Timeline for d1dlub2:

• d1dlub2 first appeared (with stable ids) in SCOP 1.55
  
• d1dlub2 appears in SCOPe 2.07