Lineage for d1ixia_ (1ixi A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879827Protein Phosphate-binding protein [53860] (4 species)
  7. 1879828Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)
  8. 1879839Domain d1ixia_: 1ixi A: [35771]
    complexed with 2hp; mutant

Details for d1ixia_

PDB Entry: 1ixi (more details), 1.89 Å

PDB Description: phosphate-binding protein mutant with asp 56 replaced by asn complex with monobasic phosphate ion
PDB Compounds: (A:) phosphate-binding protein

SCOPe Domain Sequences for d1ixia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixia_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasnapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrradgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveyayakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

SCOPe Domain Coordinates for d1ixia_:

Click to download the PDB-style file with coordinates for d1ixia_.
(The format of our PDB-style files is described here.)

Timeline for d1ixia_: