Lineage for d1ixi__ (1ixi -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28133Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins)
  6. 28244Protein Phosphate-binding protein [53860] (1 species)
  7. 28245Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)
  8. 28256Domain d1ixi__: 1ixi - [35771]

Details for d1ixi__

PDB Entry: 1ixi (more details), 1.89 Å

PDB Description: phosphate-binding protein mutant with asp 56 replaced by asn complex with monobasic phosphate ion

SCOP Domain Sequences for d1ixi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixi__ c.94.1.1 (-) Phosphate-binding protein {Escherichia coli}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasnapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrradgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveyayakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

SCOP Domain Coordinates for d1ixi__:

Click to download the PDB-style file with coordinates for d1ixi__.
(The format of our PDB-style files is described here.)

Timeline for d1ixi__: