Class b: All beta proteins [48724] (178 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) |
Family b.77.2.0: automated matches [254290] (1 protein) not a true family |
Protein automated matches [254673] (3 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [255813] (7 PDB entries) |
Domain d6dj4a2: 6dj4 A:256-462 [357332] Other proteins in same PDB: d6dj4a1, d6dj4a3 automated match to d1ciya2 |
PDB Entry: 6dj4 (more details), 3.01 Å
SCOPe Domain Sequences for d6dj4a2:
Sequence, based on SEQRES records: (download)
>d6dj4a2 b.77.2.0 (A:256-462) automated matches {Bacillus thuringiensis [TaxId: 1428]} pirtvsqltreiytnpvlenfdgsfrgsaqgiegsirsphlmdilnsitiytdahrgeyy wsghqimaspvgfsgpeftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfnigi nnqqlsvldgtefaygtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsm frsgfsnssvsiirapmfswihrsaef
>d6dj4a2 b.77.2.0 (A:256-462) automated matches {Bacillus thuringiensis [TaxId: 1428]} pirtvsqltreiytnpvlenfdgsfrgsaqgiegsirsphlmdilnsitiytdahrgeyy wsghqimaspvgfsgpeftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfnnnq qlsvldgtefaygtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrs gfsnssvsiirapmfswihrsaef
Timeline for d6dj4a2: