Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) automatically mapped to Pfam PF03945 |
Family f.1.3.0: automated matches [254289] (1 protein) not a true family |
Protein automated matches [254672] (2 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [255812] (7 PDB entries) |
Domain d6dj4a1: 6dj4 A:33-255 [357331] Other proteins in same PDB: d6dj4a2, d6dj4a3 automated match to d1ciya3 |
PDB Entry: 6dj4 (more details), 3.01 Å
SCOPe Domain Sequences for d6dj4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dj4a1 f.1.3.0 (A:33-255) automated matches {Bacillus thuringiensis [TaxId: 1428]} ytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieefa rnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavqn yqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdhavrwyn tglervwgpdsrdwirynqfrreltltvldivslfpnydsrty
Timeline for d6dj4a1: