Lineage for d6dj4a1 (6dj4 A:33-255)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626637Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 2626661Family f.1.3.0: automated matches [254289] (1 protein)
    not a true family
  6. 2626662Protein automated matches [254672] (2 species)
    not a true protein
  7. 2626663Species Bacillus thuringiensis [TaxId:1428] [255812] (7 PDB entries)
  8. 2626676Domain d6dj4a1: 6dj4 A:33-255 [357331]
    Other proteins in same PDB: d6dj4a2, d6dj4a3
    automated match to d1ciya3

Details for d6dj4a1

PDB Entry: 6dj4 (more details), 3.01 Å

PDB Description: crystal structure of bacillus thuringiensis cry1a.105 tryptic core
PDB Compounds: (A:) Cry1A.105

SCOPe Domain Sequences for d6dj4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dj4a1 f.1.3.0 (A:33-255) automated matches {Bacillus thuringiensis [TaxId: 1428]}
ytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieefa
rnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavqn
yqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdhavrwyn
tglervwgpdsrdwirynqfrreltltvldivslfpnydsrty

SCOPe Domain Coordinates for d6dj4a1:

Click to download the PDB-style file with coordinates for d6dj4a1.
(The format of our PDB-style files is described here.)

Timeline for d6dj4a1: