Lineage for d6dj4a2 (6dj4 A:256-462)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402521Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2402528Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) (S)
  5. 2402541Family b.77.2.0: automated matches [254290] (1 protein)
    not a true family
  6. 2402542Protein automated matches [254673] (3 species)
    not a true protein
  7. 2402543Species Bacillus thuringiensis [TaxId:1428] [255813] (3 PDB entries)
  8. 3057270Domain d6dj4a2: 6dj4 A:256-462 [357332]
    Other proteins in same PDB: d6dj4a1, d6dj4a3
    automated match to d1ciya2

Details for d6dj4a2

PDB Entry: 6dj4 (more details), 3.01 Å

PDB Description: crystal structure of bacillus thuringiensis cry1a.105 tryptic core
PDB Compounds: (A:) Cry1A.105

SCOPe Domain Sequences for d6dj4a2:

Sequence, based on SEQRES records: (download)

>d6dj4a2 b.77.2.0 (A:256-462) automated matches {Bacillus thuringiensis [TaxId: 1428]}
pirtvsqltreiytnpvlenfdgsfrgsaqgiegsirsphlmdilnsitiytdahrgeyy
wsghqimaspvgfsgpeftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfnigi
nnqqlsvldgtefaygtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsm
frsgfsnssvsiirapmfswihrsaef

Sequence, based on observed residues (ATOM records): (download)

>d6dj4a2 b.77.2.0 (A:256-462) automated matches {Bacillus thuringiensis [TaxId: 1428]}
pirtvsqltreiytnpvlenfdgsfrgsaqgiegsirsphlmdilnsitiytdahrgeyy
wsghqimaspvgfsgpeftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfnnnq
qlsvldgtefaygtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrs
gfsnssvsiirapmfswihrsaef

SCOPe Domain Coordinates for d6dj4a2:

Click to download the PDB-style file with coordinates for d6dj4a2.
(The format of our PDB-style files is described here.)

Timeline for d6dj4a2:

  • d6dj4a2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13