Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries) |
Domain d5wyna2: 5wyn A:226-325 [355903] Other proteins in same PDB: d5wyna1, d5wyna3 automated match to d5m3na2 complexed with cl, mes; mutant |
PDB Entry: 5wyn (more details), 2.05 Å
SCOPe Domain Sequences for d5wyna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wyna2 b.36.1.0 (A:226-325) automated matches {Human (Homo sapiens) [TaxId: 9606]} rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige qmvqnaedvweavrtqsqlavqirrgretltlyvtpevte
Timeline for d5wyna2: