Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (27 species) not a true protein |
Species Methanosarcina mazei [TaxId:192952] [354310] (4 PDB entries) |
Domain d5xv0a1: 5xv0 A:1-228 [354433] Other proteins in same PDB: d5xv0a2, d5xv0f2 automated match to d2azna1 complexed with nap; mutant |
PDB Entry: 5xv0 (more details), 1.95 Å
SCOPe Domain Sequences for d5xv0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xv0a1 c.71.1.0 (A:1-228) automated matches {Methanosarcina mazei [TaxId: 192952]} mdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaimvgigtvladdps ltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriiavsnsapeekir mleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgn liiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn
Timeline for d5xv0a1: