SCOPe 2.07: Domain d5xv0f1: 5xv0 F:1-228

Lineage for d5xv0f1 (5xv0 F:1-228)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (27 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [354310] (4 PDB entries)

8. Domain d5xv0f1: 5xv0 F:1-228 [354422]
   Other proteins in same PDB: d5xv0a2, d5xv0f2
   automated match to d2azna1
   complexed with nap; mutant

Details for d5xv0f1

PDB Entry: 5xv0, 1.95 Å

PDB Description: crystal structure of rib7 mutant d33n from methanosarcina mazei

PDB Compounds: (F:) conserved protein

SCOPe Domain Sequences for d5xv0f1:

Sequence; same for both SEQRES and ATOM records:

>d5xv0f1 c.71.1.0 (F:1-228) automated matches {Methanosarcina mazei [TaxId: 192952]}
mdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaimvgigtvladdps
ltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriiavsnsapeekir
mleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgn
liiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn

Timeline for d5xv0f1:

• d5xv0f1 is new in SCOPe 2.07-stable
  
• d5xv0f1 appears in the current release, SCOPe 2.08