Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins) Pfam PF01872 |
Protein HTP reductase [142705] (1 species) monofunctional 5-amino-6-(5-phosphoribosylamino)uracil reductase |
Species Methanococcus jannaschii [TaxId:2190] [142706] (1 PDB entry) Uniprot Q58085 6-224 |
Domain d2azna1: 2azn A:6-224 [127608] Other proteins in same PDB: d2aznb_, d2aznc_, d2aznd_, d2azne_, d2aznf_ complexed with epe, ma5, nap |
PDB Entry: 2azn (more details), 2.7 Å
SCOPe Domain Sequences for d2azna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azna1 c.71.1.2 (A:6-224) HTP reductase {Methanococcus jannaschii [TaxId: 2190]} ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke aptyvdgegfktvdecvklelknfyrlgegivlefkvkk
Timeline for d2azna1: