Class b: All beta proteins [48724] (180 folds) |
Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) automatically mapped to Pfam PF00431 |
Family b.23.1.0: automated matches [254288] (1 protein) not a true family |
Protein automated matches [254671] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries) |
Domain d6fzvd1: 6fzv D:8-125 [354280] automated match to d5cisa3 complexed with ca, cl, flc |
PDB Entry: 6fzv (more details), 2.7 Å
SCOPe Domain Sequences for d6fzvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fzvd1 b.23.1.0 (D:8-125) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvflcggdvkgesgyvasegfpnlyppnkeciwtitvpegqtvslsfrvfdlelhpacry dalevfagsgtsgqrlgrfcgtfrpaplvapgnqvtlrmttdegtggrgfllwysgra
Timeline for d6fzvd1: