SCOPe 2.08: Domain d6d6sb3: 6d6s B:248-432

Lineage for d6d6sb3 (6d6s B:248-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families)
   there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)

5. Family a.223.1.0: automated matches [256442] (1 protein)
   not a true family

6. Protein automated matches [256443] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [353449] (1 PDB entry)

8. Domain d6d6sb3: 6d6s B:248-432 [353450]
   Other proteins in same PDB: d6d6sa1, d6d6sa2, d6d6sb1, d6d6sb2
   automated match to d1w26a1

Details for d6d6sb3

PDB Entry: 6d6s

PDB Description: solution structure of trigger factor dimer

PDB Compounds: (B:) Trigger Factor

SCOPe Domain Sequences for d6d6sb3:

Sequence; same for both SEQRES and ATOM records:

>d6d6sb3 a.223.1.0 (B:248-432) automated matches {Escherichia coli [TaxId: 83333]}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa

Timeline for d6d6sb3:

• d6d6sb3 first appeared in SCOPe 2.07