SCOPe 2.07: Domain d6bxac_: 6bxa C:

Lineage for d6bxac_ (6bxa C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (18 PDB entries)

8. Domain d6bxac_: 6bxa C: [351820]
   automated match to d3e6ja_
   complexed with edo, nag

Details for d6bxac_

PDB Entry: 6bxa, 2.3 Å

PDB Description: crystal structure of n-terminal fragment of zebrafish toll-like receptor 5 (tlr5) with lamprey variable lymphocyte receptor 2 (vlr2) bound

PDB Compounds: (C:) Variable Lymphocyte Receptor 2

SCOPe Domain Sequences for d6bxac_:

Sequence; same for both SEQRES and ATOM records:

>d6bxac_ c.10.2.0 (C:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
acpsqcscsgttvdcsgkslasvptgiptttqvlglssnqitklepgvfdslvnlqilvl
yqnqlttlpagvfdrlinlkelyfsnnqltslpagvfdkltqltrlelqtnqlksiprga
fdnlksltniylfnnpwdcecsdilylknwivqhasivnpdghggvdnvkcsgtntpvra
vteastspskcp

Timeline for d6bxac_:

• d6bxac_ is new in SCOPe 2.07-stable
  
• d6bxac_ appears in the current release, SCOPe 2.08