Lineage for d6bxac_ (6bxa C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435341Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2435342Protein automated matches [190787] (12 species)
    not a true protein
  7. 2435399Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (11 PDB entries)
  8. 3051758Domain d6bxac_: 6bxa C: [351820]
    automated match to d3e6ja_
    complexed with edo, nag

Details for d6bxac_

PDB Entry: 6bxa (more details), 2.3 Å

PDB Description: crystal structure of n-terminal fragment of zebrafish toll-like receptor 5 (tlr5) with lamprey variable lymphocyte receptor 2 (vlr2) bound
PDB Compounds: (C:) Variable Lymphocyte Receptor 2

SCOPe Domain Sequences for d6bxac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bxac_ c.10.2.0 (C:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
acpsqcscsgttvdcsgkslasvptgiptttqvlglssnqitklepgvfdslvnlqilvl
yqnqlttlpagvfdrlinlkelyfsnnqltslpagvfdkltqltrlelqtnqlksiprga
fdnlksltniylfnnpwdcecsdilylknwivqhasivnpdghggvdnvkcsgtntpvra
vteastspskcp

SCOPe Domain Coordinates for d6bxac_:

Click to download the PDB-style file with coordinates for d6bxac_.
(The format of our PDB-style files is described here.)

Timeline for d6bxac_:

  • d6bxac_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-09