Lineage for d5y5si_ (5y5s I:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021656Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 3021657Protein automated matches [254444] (10 species)
    not a true protein
  7. 3021764Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries)
  8. 3021781Domain d5y5si_: 5y5s I: [351114]
    Other proteins in same PDB: d5y5sc_, d5y5sh1, d5y5sh2, d5y5sm_
    automated match to d3wmm1_
    complexed with bcl, bph, ca, cdl, crt, fe, gol, hec, lda, lhg, lmt, mg, mq8, pef, pgv, so4, unl, uq8

Details for d5y5si_

PDB Entry: 5y5s (more details), 1.9 Å

PDB Description: structure of photosynthetic lh1-rc super-complex at 1.9 angstrom resolution
PDB Compounds: (I:) LH1 alpha polypeptide

SCOPe Domain Sequences for d5y5si_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5si_ f.3.1.0 (I:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg

SCOPe Domain Coordinates for d5y5si_:

Click to download the PDB-style file with coordinates for d5y5si_.
(The format of our PDB-style files is described here.)

Timeline for d5y5si_: