SCOPe 2.08: Domain d6exoa_: 6exo A:

Lineage for d6exoa_ (6exo A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (12 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:31286] [188393] (5 PDB entries)

8. Domain d6exoa_: 6exo A: [350873]
   automated match to d2p86a_
   complexed with c3e, edo

Details for d6exoa_

PDB Entry: 6exo, 1.9 Å

PDB Description: crystal structure of rhodesain in complex with a macrolactam inhibitor

PDB Compounds: (A:) Cysteine protease

SCOPe Domain Sequences for d6exoa_:

Sequence; same for both SEQRES and ATOM records:

>d6exoa_ d.3.1.1 (A:) automated matches {Trypanosoma brucei [TaxId: 31286]}
apaavdwrekgavtpvkdqgqcgscwafstigniegqwqvagnplvslseqmlvscdtid
fgcggglmdnafnwivnsnggnvfteasypyvsgngeqpqcqmngheigaaitdhvdlpq
dedaiaaylaengplaiavdatsfmdynggiltsctseqldhgvllvgyndasnppywii
knswsnmwgedgyiriekgtnqclmnqavssavvg

Timeline for d6exoa_:

• d6exoa_ first appeared in SCOPe 2.07