Lineage for d6cu3b_ (6cu3 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502577Species Naegleria fowleri [TaxId:5763] [350234] (2 PDB entries)
  8. 2502579Domain d6cu3b_: 6cu3 B: [350399]
    automated match to d1oria_
    complexed with edo

Details for d6cu3b_

PDB Entry: 6cu3 (more details), 2.5 Å

PDB Description: crystal structure of a protein arginine n-methyltransferase from naegleria fowleri
PDB Compounds: (B:) protein arginine N-methyltransferase

SCOPe Domain Sequences for d6cu3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cu3b_ c.66.1.0 (B:) automated matches {Naegleria fowleri [TaxId: 5763]}
iheemlkdgirtnayknailqnkhlfkdkvvldigcgtgilclfaakagakrvigidmsd
iidkarqivsdngyshvielikgkvediaqlpfgiekvdiiisewmgyfllyesmlqtvl
sardrwlrpggylfpdkctmyicgiedseykrdkidfwdnvygfnfsaikadalreplvd
fvesqqiittqskfleidlntiqpedlkqittsfeftsqyqeycqafvawfdcvfsrgph
kpvefstgpftegthwkqtvfylendlplkpndvikgtitisqnksnhrdldismkytvn
ggavisqdyimr

SCOPe Domain Coordinates for d6cu3b_:

Click to download the PDB-style file with coordinates for d6cu3b_.
(The format of our PDB-style files is described here.)

Timeline for d6cu3b_: