Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Naegleria fowleri [TaxId:5763] [350234] (2 PDB entries) |
Domain d6cu3f_: 6cu3 F: [350252] automated match to d1oria_ complexed with edo |
PDB Entry: 6cu3 (more details), 2.5 Å
SCOPe Domain Sequences for d6cu3f_:
Sequence, based on SEQRES records: (download)
>d6cu3f_ c.66.1.0 (F:) automated matches {Naegleria fowleri [TaxId: 5763]} emlkdgirtnayknailqnkhlfkdkvvldigcgtgilclfaakagakrvigidmsdiid karqivsdngyshvielikgkvediaqlpfgiekvdiiisewmgyfllyesmlqtvlsar drwlrpggylfpdkctmyicgiedseykrdkidfwdnvygfnfsaikadalreplvdfve sqqiittqskfleidlntiqpedlkqittsfeftsqyqeycqafvawfdcvfsrgphkpv efstgpftegthwkqtvfylendlplkpndvikgtitisqnksnhrdldismkytvngga visqdyimr
>d6cu3f_ c.66.1.0 (F:) automated matches {Naegleria fowleri [TaxId: 5763]} emlkdgirtnayknailqnlfkdkvvldigcgtgilclfaakagasdiidkarqivsdng yshvielikgkveisewmgyfllyesmlqtvlsardrwldkctmyicgiedseykrdkid fwdnvygfnfsaikadalreplvdfvesqqiittqskfleidlntiqpedlkqittsfef tsqyqeycqafvawfdcvfsvefstgpftegthwkqtvfylendlplkpndvikgtitis qnksnhrdldismkytvnggavisqdyimr
Timeline for d6cu3f_: