SCOPe 2.07: Domain d6bnla1: 6bnl A:6-185

Lineage for d6bnla1 (6bnl A:6-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6bnla1: 6bnl A:6-185 [349968]
   Other proteins in same PDB: d6bnla2, d6bnlb_, d6bnlc1, d6bnlc2, d6bnld1, d6bnld2, d6bnle2, d6bnlf_, d6bnlg1, d6bnlg2, d6bnlh1, d6bnlh2
   automated match to d1zt4c2
   complexed with nag, qwv

Details for d6bnla1

PDB Entry: 6bnl, 2.6 Å

PDB Description: crystal structure of tcr-mhc-like molecule

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6bnla1:

Sequence; same for both SEQRES and ATOM records:

>d6bnla1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6bnla1:

• d6bnla1 is new in SCOPe 2.07-stable
  
• d6bnla1 appears in the current release, SCOPe 2.08