Lineage for d6bnla1 (6bnl A:6-185)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507687Species Mouse (Mus musculus) [TaxId:10090] [224924] (65 PDB entries)
  8. 3049906Domain d6bnla1: 6bnl A:6-185 [349968]
    Other proteins in same PDB: d6bnla2, d6bnlb_, d6bnlc1, d6bnlc2, d6bnld1, d6bnld2, d6bnle2, d6bnlf_, d6bnlg1, d6bnlg2, d6bnlh1, d6bnlh2
    automated match to d1zt4c2
    complexed with nag, qwv

Details for d6bnla1

PDB Entry: 6bnl (more details), 2.6 Å

PDB Description: crystal structure of tcr-mhc-like molecule
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6bnla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bnla1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d6bnla1:

Click to download the PDB-style file with coordinates for d6bnla1.
(The format of our PDB-style files is described here.)

Timeline for d6bnla1:

  • d6bnla1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07