Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d6bnlc2: 6bnl C:118-205 [350112] Other proteins in same PDB: d6bnla1, d6bnla2, d6bnlb_, d6bnlc1, d6bnld1, d6bnld2, d6bnle1, d6bnle2, d6bnlf_, d6bnlg1, d6bnlh1, d6bnlh2 automated match to d4eura2 complexed with nag, qwv |
PDB Entry: 6bnl (more details), 2.6 Å
SCOPe Domain Sequences for d6bnlc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bnlc2 b.1.1.2 (C:118-205) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
Timeline for d6bnlc2: