SCOPe 2.07: Domain d6bmkc1: 6bmk C:8-185

Lineage for d6bmkc1 (6bmk C:8-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6bmkc1: 6bmk C:8-185 [349730]
   Other proteins in same PDB: d6bmka2, d6bmkb_, d6bmkc2, d6bmkd_
   automated match to d1zt4c2
   complexed with f57, nag

Details for d6bmkc1

PDB Entry: 6bmk, 2.43 Å

PDB Description: crystal structure of mhc-i like protein

PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d2

SCOPe Domain Sequences for d6bmkc1:

Sequence; same for both SEQRES and ATOM records:

>d6bmkc1 d.19.1.0 (C:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqtssfaniswsrtdslillgdlqthrwsndsaiisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlstgcemypgnasesffhvafqgkyavr
frgtswqrvlgapswldlpikvlnadqgtsatvqtllndtwpqfarglleagksdlek

Timeline for d6bmkc1:

• d6bmkc1 is new in SCOPe 2.07-stable
  
• d6bmkc1 appears in the current release, SCOPe 2.08