Lineage for d6bmka1 (6bmk A:8-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545946Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2546006Domain d6bmka1: 6bmk A:8-185 [349693]
    Other proteins in same PDB: d6bmka2, d6bmkb_, d6bmkc2, d6bmkd_
    automated match to d1zt4c2
    complexed with f57, nag

Details for d6bmka1

PDB Entry: 6bmk (more details), 2.43 Å

PDB Description: crystal structure of mhc-i like protein
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d2

SCOPe Domain Sequences for d6bmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bmka1 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqtssfaniswsrtdslillgdlqthrwsndsaiisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlstgcemypgnasesffhvafqgkyavr
frgtswqrvlgapswldlpikvlnadqgtsatvqtllndtwpqfarglleagksdlek

SCOPe Domain Coordinates for d6bmka1:

Click to download the PDB-style file with coordinates for d6bmka1.
(The format of our PDB-style files is described here.)

Timeline for d6bmka1: