Lineage for d6bmkc1 (6bmk C:8-185)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507687Species Mouse (Mus musculus) [TaxId:10090] [224924] (65 PDB entries)
  8. 3049668Domain d6bmkc1: 6bmk C:8-185 [349730]
    Other proteins in same PDB: d6bmka2, d6bmkb_, d6bmkc2, d6bmkd_
    automated match to d1zt4c2
    complexed with f57, nag

Details for d6bmkc1

PDB Entry: 6bmk (more details), 2.43 Å

PDB Description: crystal structure of mhc-i like protein
PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d2

SCOPe Domain Sequences for d6bmkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bmkc1 d.19.1.0 (C:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqtssfaniswsrtdslillgdlqthrwsndsaiisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlstgcemypgnasesffhvafqgkyavr
frgtswqrvlgapswldlpikvlnadqgtsatvqtllndtwpqfarglleagksdlek

SCOPe Domain Coordinates for d6bmkc1:

Click to download the PDB-style file with coordinates for d6bmkc1.
(The format of our PDB-style files is described here.)

Timeline for d6bmkc1:

  • d6bmkc1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07