Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein automated matches [190964] (6 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [348384] (1 PDB entry) |
Domain d5x6fa_: 5x6f A: [348698] automated match to d4rukb_ complexed with gol, ipa |
PDB Entry: 5x6f (more details), 2.59 Å
SCOPe Domain Sequences for d5x6fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x6fa_ c.26.1.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps ekysfisstlvreiaalggdiskfvhpavadalaerfk
Timeline for d5x6fa_: