Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347873] (2 PDB entries) |
Domain d5vdeb_: 5vde B: [348055] automated match to d1cc7a_ complexed with cu1 |
PDB Entry: 5vde (more details), 1.65 Å
SCOPe Domain Sequences for d5vdeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vdeb_ d.58.17.1 (B:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik ktgkevrsgkql
Timeline for d5vdeb_: