Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (13 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries) Uniprot P02593 |
Domain d5v02r_: 5v02 R: [348016] Other proteins in same PDB: d5v02b1, d5v02b2, d5v02b3 automated match to d1iq5a_ complexed with 657, ca, gol, so4 |
PDB Entry: 5v02 (more details), 1.78 Å
SCOPe Domain Sequences for d5v02r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v02r_ a.39.1.5 (R:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev demireadidgdgqvnyeefvqmmta
Timeline for d5v02r_: