SCOPe 2.08: Domain d5ooib_: 5ooi B:

Lineage for d5ooib_ (5ooi B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d5ooib_: 5ooi B: [347280]
   automated match to d3at3a_
   complexed with 9ye, act, edo, na

Details for d5ooib_

PDB Entry: 5ooi, 2 Å

PDB Description: structure of protein kinase ck2 catalytic subunit (isoform ck2alpha') in complex with the indenoindole-type inhibitor 4p

PDB Compounds: (B:) Casein kinase II subunit alpha'

SCOPe Domain Sequences for d5ooib_:

Sequence; same for both SEQRES and ATOM records:

>d5ooib_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevfeainitnnerv
vvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqly
qiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpa
qeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvri
akvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkll
rydhqqrltakeamehpyfypvvke

Timeline for d5ooib_:

• d5ooib_ first appeared in SCOPe 2.07