SCOPe 2.07: Domain d5ufda_: 5ufd A:

Lineage for d5ufda_ (5ufd A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (18 PDB entries)

8. Domain d5ufda_: 5ufd A: [345855]
   automated match to d5wk4e_
   complexed with mg

Details for d5ufda_

PDB Entry: 5ufd, 1.7 Å

PDB Description: crystal structure of variable lymphocyte receptor (vlr) rbc36 (apo)

PDB Compounds: (A:) rbc36

SCOPe Domain Sequences for d5ufda_:

Sequence; same for both SEQRES and ATOM records:

>d5ufda_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
adpghhhhhhggcpsqcscsgttvdcrskrhasvpagiptnaqilylhdnqitklepgvf
dslinlkelylgsnqlgalpvgvfdsltqltvldlgtnqltvlpsavfdrlvhlkelfmc
cnkltelprgierlthlthlaldqnqlksiphgafdrlsslthaylfgnpwdcecrdimy
lrnwvadhtsiamrwdgkavndpdsakcagtntpvravteastspskcp

Timeline for d5ufda_:

• d5ufda_ is new in SCOPe 2.07-stable
  
• d5ufda_ appears in the current release, SCOPe 2.08