SCOPe 2.07: Domain d4cr2u2: 4cr2 U:188-308

Lineage for d4cr2u2 (4cr2 U:188-308)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.39: Proteasome regulatory subunits coiled coil regions [345933] (1 family)
   Not a true superfamily

5. Family h.1.39.1: Proteasome regulatory subunits coiled coil regions [345991] (3 proteins)

6. Protein Proteasome regulatory subunit Rpn8 coiled coil regions [346133] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346446] (1 PDB entry)

8. Domain d4cr2u2: 4cr2 U:188-308 [345200]
   Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr2u2

PDB Entry: 4cr2, 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome

PDB Compounds: (U:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4cr2u2:

Sequence, based on SEQRES records:

>d4cr2u2 h.1.39.1 (U:188-308) Proteasome regulatory subunit Rpn8 coiled coil regions {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
irltnqlkslkglqsklkdvveyldkvinkelpinhtilgklqdvfnllpnlgtpdddei
dvenhdrinisnnlqkaltvktndelmviyisnlvrsiiafddlienkiqnkkiqeqrvk
d

Sequence, based on observed residues (ATOM records):

>d4cr2u2 h.1.39.1 (U:188-308) Proteasome regulatory subunit Rpn8 coiled coil regions {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
irltnqlkslkglqsklkdvveyldkvihtilgklqdvfnlnnlqkaltvktndelmviy
isnlvrsiiafddlienkiqnkkiqeqrvkd

Timeline for d4cr2u2:

• d4cr2u2 is new in SCOPe 2.07-stable
  
• d4cr2u2 appears in the current release, SCOPe 2.08