SCOPe 2.07: Domain d4cr21_: 4cr2 1:

Lineage for d4cr21_ (4cr2 1:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4cr21_: 4cr2 1: [345152]
   Other proteins in same PDB: d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr21_

PDB Entry: 4cr2, 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome

PDB Compounds: (1:) Proteasome component PRE3

SCOPe Domain Sequences for d4cr21_:

Sequence; same for both SEQRES and ATOM records:

>d4cr21_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkkgevslgtsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaad
tqaiadivqyhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevy
tiplggsvhklpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssgg
virmvvltaagverlifypdeyeql

Timeline for d4cr21_:

• d4cr21_ is new in SCOPe 2.07-stable
  
• d4cr21_ appears in the current release, SCOPe 2.08