Lineage for d5j61h_ (5j61 H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920849Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2920850Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2920897Family c.110.1.0: automated matches [191422] (1 protein)
    not a true family
  6. 2920898Protein automated matches [190596] (6 species)
    not a true protein
  7. 2920935Species Plasmodium falciparum [TaxId:36329] [196467] (14 PDB entries)
  8. 2920951Domain d5j61h_: 5j61 H: [344285]
    automated match to d4nbia_
    protein/RNA complex; complexed with a3g

Details for d5j61h_

PDB Entry: 5j61 (more details), 2.1 Å

PDB Description: d-aminoacyl-trna deacylase (dtd) from plasmodium falciparum in complex with glycyl-3'-aminoadenosine at 2.10 angstrom resolution
PDB Compounds: (H:) D-tyrosyl-tRNA(Tyr) deacylase

SCOPe Domain Sequences for d5j61h_:

Sequence, based on SEQRES records: (download)

>d5j61h_ c.110.1.0 (H:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
defkkqynddkikigkfgnymnidvtndgpvtiyidthd

Sequence, based on observed residues (ATOM records): (download)

>d5j61h_ c.110.1.0 (H:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrkleiiseiknglicflgihkndtwedalyiirkclnlrlwnndn
ktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynd
dkikigkfgnymnidvtndgpvtiyidthd

SCOPe Domain Coordinates for d5j61h_:

Click to download the PDB-style file with coordinates for d5j61h_.
(The format of our PDB-style files is described here.)

Timeline for d5j61h_: