Lineage for d4nbia_ (4nbi A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.110: DTD-like [69499] (1 superfamily)
beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinCSuperfamily c.110.1: DTD-like [69500] (3 families) 
active form is a dimer
Family c.110.1.0: automated matches [191422] (1 protein)
not a true familyProtein automated matches [190596] (6 species)
not a true protein
Species Plasmodium falciparum [TaxId:36329] [196467] (14 PDB entries) 
Domain d4nbia_: 4nbi A: [229940]
automated match to d3ko5c_
protein/RNA complex; complexed with d3y, pge
Details for d4nbia_
PDB Entry: 4nbi (more details), 1.86 Å
PDB Description: d-aminoacyl-trna deacylase (dtd) from plasmodium falciparum in complex with d-tyrosyl-3'-aminoadenosine at 1.86 angstrom resolution
PDB Compounds: (A:) D-tyrosyl-tRNA(Tyr) deacylaseSCOPe Domain Sequences for d4nbia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nbia_ c.110.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
defkkqynddkikigkfgnymnidvtndgpvtiyidthdinln
SCOPe Domain Coordinates for d4nbia_:
Click to download the PDB-style file with coordinates for d4nbia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4nbia_:
- d4nbia_ first appeared in SCOPe 2.03
- d4nbia_ appears in SCOPe 2.07
View in 3D
